PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009768885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 433aa    MW: 47139.8 Da    PI: 8.59
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009768885.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.53.5e-14349400556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                     +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN  Lk+ l el+ + 
  XP_009768885.1 349 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAELERKR 400
                     79*******************************************9999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-14345409IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.783347399IPR004827Basic-leucine zipper domain
CDDcd147071.64E-23349403No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-14349402No hitNo description
SuperFamilySSF579591.5E-10349399No hitNo description
PfamPF001704.7E-12349401IPR004827Basic-leucine zipper domain
PROSITE patternPS000360352367IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGVPESEVVS QGEVESPLQP DQNQHKNHQF PSLGRQASIY SLTLDEFQHT LCESGKNFGS  60
MNMDEFLNSI WTAEENQAHA HAHAHAAHGH AHEHSHAHSQ APSTGEATST PHFAIGQSNV  120
SMEKAIAKQP SLPRQGSLTL PEPLCRKTVD EVWSEIHKSQ KEQHQNNGGS VPDTGNSAQR  180
QVTFGEMTLE DFLVKAGVVR EQENAPAPPQ QQSYMMYQNS NNPAMANMAR PVIGLGGVTG  240
SVGVGIPSYP PLPQTGVVEA PIYPVSMKRG AGFPQQPTAV YGGRMGNGGG VGYGQVQGVA  300
GMGSPLSPVS SDGLCVNQVD SGGQYGLEMG MRGGRKRIID GPVEKVVERR QRRMIKNRES  360
AARSRARKQA YTVELEAELN QLKEENAHLK QALAELERKR KQQYFDEGKM KVQTKAQKAT  420
NKLRGMRRSL SCP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281289GGRMGNGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768885.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1
SwissprotQ9SJN01e-119ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLK4CQX80.0K4CQX8_SOLLC; Uncharacterized protein
STRINGSolyc09g009490.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61552433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-111bZIP family protein